PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028415.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 472aa    MW: 52587.5 Da    PI: 5.993
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028415.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS466.61.4e-142464681374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lLl+cA++v++g+le+a+a+L+++s+las dgd+mqR+aayfteALa r+++ +++l  al++++ s   +see+ ++k+f+e+ P+lk++ +++
  Pbr028415.1  46 LIHLLLTCANHVATGSLENANAALEQISQLASADGDTMQRIAAYFTEALADRILKAWPGLHTALNSTKIS--LVSEEILVRKVFFEMLPFLKVAVVLT 141
                  689*************************************************************999997..7************************* PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaI+ea+ege++vHiiD+++ +++QW+aLlq L++Rpegpp+lRiTgv++    +k+ l ++++rL+++Ae+l++pf+f + ++++le+l++++Lrv
  Pbr028415.1 142 NQAIMEAMEGEKMVHIIDLNAAEPAQWIALLQVLSARPEGPPHLRITGVHQ----QKDVLDQMAHRLTEVAEKLDIPFQFCP-IVSKLENLDMDKLRV 234
                  ***************************************************....9**************************.7999*********** PP

         GRAS 197 kpgEalaVnlvlqlhrll......................................................desvsles..erdevLklvkslsPkv 238
                  k+gEalaV++vlqlh+ll                                                      ++++sl+   + d++L+++++l Pkv
  Pbr028415.1 235 KTGEALAVSSVLQLHSLLasddellkrksplaskgsngnhlpralqmsqgtlgellekemgnryspspdstsSSPLSLTPsaKLDSFLNAFWDLTPKV 332
                  ********************************************************************999855555544457899************ PP

         GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                  +v++eq+++hn+++++er+leal+ y++lfd+le+++pr+s er kvE++l+g+ei+n++aceg+er+erhe+lekW +rl+ aGF++vpls++ + q
  Pbr028415.1 333 MVITEQDSNHNGSTLMERLLEALYSYATLFDCLESTMPRTSLERLKVEKMLFGEEIKNIIACEGSERIERHEKLEKWIQRLDLAGFGNVPLSYYGMLQ 430
                  ************************************************************************************************** PP

         GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ak++l+ ++ +gyr+ ee+g+++  W+drpL+svSaWr
  Pbr028415.1 431 AKRMLQGYGCNGYRMREENGCVLVSWQDRPLFSVSAWR 468
                  *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.0520448IPR005202Transcription factor GRAS
PfamPF035144.9E-14046468IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MFQDEGSSSA PSSPLQFFST MSLSPSLGSP YPWLKELKSE ERGLYLIHLL LTCANHVATG  60
SLENANAALE QISQLASADG DTMQRIAAYF TEALADRILK AWPGLHTALN STKISLVSEE  120
ILVRKVFFEM LPFLKVAVVL TNQAIMEAME GEKMVHIIDL NAAEPAQWIA LLQVLSARPE  180
GPPHLRITGV HQQKDVLDQM AHRLTEVAEK LDIPFQFCPI VSKLENLDMD KLRVKTGEAL  240
AVSSVLQLHS LLASDDELLK RKSPLASKGS NGNHLPRALQ MSQGTLGELL EKEMGNRYSP  300
SPDSTSSSPL SLTPSAKLDS FLNAFWDLTP KVMVITEQDS NHNGSTLMER LLEALYSYAT  360
LFDCLESTMP RTSLERLKVE KMLFGEEIKN IIACEGSERI ERHEKLEKWI QRLDLAGFGN  420
VPLSYYGMLQ AKRMLQGYGC NGYRMREENG CVLVSWQDRP LFSVSAWRCR K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-46464684375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356076.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM5WFN20.0M5WFN2_PRUPE; Uncharacterized protein
STRINGVIT_06s0009g02390.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3